PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt

H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt

Product description

The PACAP selective antagonist PACAP (6-38) is a potent and selective inhibitor of PACAP-27-stimulated pituitary adenylate cyclase with a Ki values of 150 nM.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	143748-18-9
Sequence	FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Synonyms	Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
Molecular Formula	C₁₈₂H₃₀₀N₅₆O₄₅S
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt

Related Product

• palmitoyl-cys-rs-2-3-di-palmitoyloxy-propyl-ala-gly-oh